PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G285600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 359aa    MW: 36740.1 Da    PI: 6.3129
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G285600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding64.42.2e-203277147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        +g+WT+eEd+ll +av+++G+++W++I+++++ gR++k+c++rw + 
  Sevir.3G285600.1.p 32 KGSWTPEEDDLLRRAVARHGPRNWSLISAEIP-GRSGKSCRLRWCNQ 77
                        799*****************************.***********985 PP

2Myb_DNA-binding59.95.7e-1984128147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r ++T+eEd ++v a++qlG++ W+tIar++  gRt++++k++w++ 
  Sevir.3G285600.1.p  84 RRPFTPEEDAIIVAAHAQLGNK-WATIARMLH-GRTDNSVKNHWNST 128
                         679*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.0772782IPR017930Myb domain
SuperFamilySSF466896.47E-3129125IPR009057Homeodomain-like
SMARTSM007179.6E-183180IPR001005SANT/Myb domain
PfamPF002492.6E-203277IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-253385IPR009057Homeodomain-like
CDDcd001677.22E-173476No hitNo description
SMARTSM007171.9E-1583131IPR001005SANT/Myb domain
PfamPF002492.5E-1584128IPR001005SANT/Myb domain
PROSITE profilePS5129421.39784133IPR017930Myb domain
CDDcd001678.51E-1286129No hitNo description
Gene3DG3DSA:1.10.10.602.6E-2386131IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MAAPSGGAGG VDGGGGPAGS GSGGGEGNGR VKGSWTPEED DLLRRAVARH GPRNWSLISA  60
EIPGRSGKSC RLRWCNQLSP GVERRPFTPE EDAIIVAAHA QLGNKWATIA RMLHGRTDNS  120
VKNHWNSTLR RQRRAAAAAA NAGCAALPLC PLAAAATAAS GPPLALRHLL LDPKESSPSP  180
ASAVPFQPLD LKRGDDGGDD EEDEEEDDED GSSEDSVLMP PPKKRPCIGV GPGQSHPSLC  240
AAKKPEHTKP LPPPTPAAPA EPVTSLTLSL PGVGGGSGAV PEAPAPQGAV SAAATSLDGV  300
AKMRAKLEQE WPWLQPVIRQ MICEEVQRHL QGAYVPCSLV ASPAAGGADG RAAASSQD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C3e-36311323104C-Myb DNA-Binding Domain
1mse_C3e-36311323104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9698541e-116EU969854.1 Zea mays clone 336503 mRNA sequence.
GenBankKJ7276591e-116KJ727659.1 Zea mays clone pUT5586 MYB transcription factor (MYB119) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963854.10.0PREDICTED: transcription factor MYB44-like
TrEMBLK3ZCR61e-172K3ZCR6_SETIT; Uncharacterized protein
STRINGSi024344m1e-171(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.12e-50myb domain protein 73